Protein Info for HGI48_RS18485 in Dickeya dianthicola 67-19

Annotation: deoxyribonuclease I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF04231: Endonuclease_1" amino acids 24 to 230 (207 residues), 158 bits, see alignment E=1.8e-50

Best Hits

Swiss-Prot: 95% identical to NUCM_DICD3: Nuclease NucM (nucM) from Dickeya dadantii (strain 3937)

KEGG orthology group: K01150, deoxyribonuclease I [EC: 3.1.21.1] (inferred from 95% identity to ddd:Dda3937_00422)

MetaCyc: 80% identical to DNA-specific endonuclease I (Escherichia coli K-12 substr. MG1655)
Deoxyribonuclease I. [EC: 3.1.21.1]

Predicted SEED Role

"Endonuclease I precursor (EC 3.1.21.1) @ Extracellular deoxyribonuclease Dns (EC 3.1.21.-)" (EC 3.1.21.-, EC 3.1.21.1)

Isozymes

Compare fitness of predicted isozymes for: 3.1.21.-

Use Curated BLAST to search for 3.1.21.- or 3.1.21.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RHG7 at UniProt or InterPro

Protein Sequence (232 amino acids)

>HGI48_RS18485 deoxyribonuclease I (Dickeya dianthicola 67-19)
MLRNFVIFAVLGAGLTTLAAAGQDINNFTQAKAAAAKIHQDAPGSFYCGCKINWQGKKGT
PDPASCGYQVRKDANRASRIEWEHVVPAWQFGHQRQCWQDGGRRNCTKDDVYRQMETDLH
NLQPSIGEVNGDRGNFMYSQWNGGEHQYGQCEMKIDFKNQLAEPPERARGAISRTYFYMR
DRYNLNLSRQQTQLFDAWNKQYPVTAWECTREKRIAAVQGNHNPYVQQACQP