Protein Info for HGI48_RS18380 in Dickeya dianthicola 67-19
Annotation: trp operon repressor
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 74% identical to TRPR_PECAS: Trp operon repressor (trpR) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
KEGG orthology group: K03720, TrpR family transcriptional regulator, trp operon repressor (inferred from 97% identity to ddd:Dda3937_00401)Predicted SEED Role
"Transcriptional repressor protein TrpR" in subsystem Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A3A4CH10 at UniProt or InterPro
Protein Sequence (110 amino acids)
>HGI48_RS18380 trp operon repressor (Dickeya dianthicola 67-19) MTSPSLHDPVFSEQDDENWQAFVSLFQRAMAEGLEQPLLQLLLTPDERTSLGTRVRIIQE LMRGEMSQRELKNELGAGIATITRGSNSLKSAPARLKVWLEEQLLPENKG