Protein Info for HGI48_RS18185 in Dickeya dianthicola 67-19

Annotation: LPS assembly protein LptD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 803 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details PF03968: LptD_N" amino acids 64 to 205 (142 residues), 80.6 bits, see alignment E=1.1e-26 PF04453: LptD" amino acids 326 to 716 (391 residues), 356.8 bits, see alignment E=1.9e-110

Best Hits

Swiss-Prot: 71% identical to LPTD_PECAS: LPS-assembly protein LptD (lptD) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K04744, LPS-assembly protein (inferred from 95% identity to ddd:Dda3937_01378)

Predicted SEED Role

"Outer membrane protein Imp, required for envelope biogenesis / Organic solvent tolerance protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RH86 at UniProt or InterPro

Protein Sequence (803 amino acids)

>HGI48_RS18185 LPS assembly protein LptD (Dickeya dianthicola 67-19)
MMPLMTEHQIPRMKKSFPTLLASLIGSALYSQQVLADLASQCMSGVPVYNRPLVTGDTNQ
LPVHIKADQSQANYPDSAVFTGNVNVEQGNRVLTADQVQLNQKPQPGQTDPIRTVTAIGN
VHYDDNQVILKGPRAWSNLNTKDTDVENGDYLMVGRQGRGDADKMKQRENNRYTILDNGS
FTSCLPGDDSWSVVGSEVIQDRQEEVAEIWNARFHIAGVPVFYSPYMQMPIGDKRRSGFL
IPSAKYGNRNGFELITPYYWNIAPNYDATITPHVQTNRGIQWQNEFRHLSRFGFSVVEFD
WLQNDKQYKNDVLSGKSGYAADENYNRWLFHWMHSGVVDQVWRINVDYTKVSDQNYFTDL
DSVYGNTTDGYATQKFSLGYATRNWDATLSTRQYQIFSNLANRDVYRAMPQLDINFAQNN
IGPFDLYLYGQAAKFTNVNPTYPDATRFHIEPTLSLPLSNGWASLSTETKLMATHYQQEN
LDTYRDNHADNTDATSLKGSVNRVMPQFKTDGKLVFERDMDWAKGYTQTLEPRAQYLYVP
YRDQSSIRAYDSTLLQADYAGLFRERTFSGLDRIASANQVSTGVTTRLYDSSLEERFNTS
LGQIYYFARPRTGTASTIDQSDNRGSLSWAGDSYWKFADNWGIRGGAQYDQRLKDFTLGD
AVLEYRGGGERMLQLNYRFASSKYIQAMLPTVTNPGFQQGISQVGATASWPLTDRWAIVG
AYYYDTKANQPADQLLGLQYSTCCWAVNVGYERKITIWNSTTNQSVYDNKLGFSFELRGL
SSNYSLGTEKMLKTGILPYQRAF