Protein Info for HGI48_RS18180 in Dickeya dianthicola 67-19

Annotation: co-chaperone DjlA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details PF05099: TerB" amino acids 63 to 171 (109 residues), 31 bits, see alignment E=2.8e-11 PF00226: DnaJ" amino acids 278 to 334 (57 residues), 32.1 bits, see alignment E=9.8e-12

Best Hits

KEGG orthology group: K05801, DnaJ like chaperone protein (inferred from 89% identity to ddd:Dda3937_01376)

Predicted SEED Role

"DnaJ-like protein DjlA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RHA1 at UniProt or InterPro

Protein Sequence (340 amino acids)

>HGI48_RS18180 co-chaperone DjlA (Dickeya dianthicola 67-19)
MRYWGKLLGLALGIASSAGVGGLIIGLLLGHLLDRARASRQRDFFSAQATRQALFCLTTF
QAMGHLAKSKGRVTESDIRIATTMMDRLELHGEARNAAQRAFREGKASLFPVRSKLRKLR
DACIGRFDLVRMFLEIQLQVAFVDGALHPSERRLLYVFADELGVTREQFELFMRNMERGN
PQSSRQSSGYQSRQNSNYQSRQNSNHQSRQNNNHQSRQNNNYQSRQNNNHQSRQNNNQSS
RQGNKSYQRRNQSYGGQSYGQRPPVSSYGPTVESACRTLGVRSSDDAVTVKRAYRKLMSE
HHPDKMMGKGLSPRMIEMAKRKAQDIQAAYEFLKINKFSH