Protein Info for HGI48_RS18010 in Dickeya dianthicola 67-19
Annotation: cell division protein FtsL
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 82% identical to FTSL_YERPE: Cell division protein FtsL (ftsL) from Yersinia pestis
KEGG orthology group: K03586, cell division protein FtsL (inferred from 95% identity to dze:Dd1591_0603)Predicted SEED Role
"Cell division protein FtsL" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A3A4CUR1 at UniProt or InterPro
Protein Sequence (107 amino acids)
>HGI48_RS18010 cell division protein FtsL (Dickeya dianthicola 67-19) MIGNERHSLGGVIGDDLLRHGKLPLLLLIAVSVSAILVVTTAHRTRLLTAERERLLLERD ALDIEWRNLILEENALGDHSRVEQIATEKLHMVHVDPSQENIVVKQQ