Protein Info for HGI48_RS17890 in Dickeya dianthicola 67-19

Annotation: carboxylating nicotinate-nucleotide diphosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)
  • amino acids 27 to 295 (269 residues), 322.9 bits, E=7.4e-101
• PF02749: QRPTase_N
  • amino acids 42 to 128 (87 residues), 79.5 bits, E=1.6e-26
• PF01729: QRPTase_C
  • amino acids 130 to 294 (165 residues), 207.7 bits, E=1e-65

Best Hits

Swiss-Prot: 69% identical to NADC_SALTY: Nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 96% identity to ddd:Dda3937_02244)

MetaCyc: 68% identical to quinolinate phosphoribosyltransferase (decarboxylating) (Escherichia coli K-12 substr. MG1655)
Nicotinate-nucleotide diphosphorylase (carboxylating). [EC: 2.4.2.19]

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• NAD de novo biosynthesis I (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (3/4 steps found)
• NAD de novo biosynthesis III (4/6 steps found)
• superpathway of NAD biosynthesis in eukaryotes (7/14 steps found)
• NAD de novo biosynthesis II (from tryptophan) (3/9 steps found)
• nicotine biosynthesis (3/9 steps found)
• superpathway of nicotine biosynthesis (4/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.19

Sequence Analysis Tools

See A0A7L9RJN4 at UniProt or InterPro

Protein Sequence (296 amino acids)

>HGI48_RS17890 carboxylating nicotinate-nucleotide diphosphorylase (Dickeya dianthicola 67-19)
MTTRRYSQEQRQAELFSRVEQDIPVSVRLALREDLGGDVSPELDITAQLLPAETLDNAVI
ITREAGVFCGQRWLDEVFRQLGGHIVIDWLVRDGDVLTENQPLCRLHGPSRILLTGERTA
LNFLQTLSGVATEVSRYVAQLAGTHTRLLDTRKTLPGLRTALKYAVLCGGGSNHRLGLSD
AFLIKENHIIAAGSIKQAVEQAFQLRSDVPVEVEVETRDELQQALDAGADIIMLDNFTLE
GIREAVTLTQGRALLEVSGNVTLQTLPDYAATGVDYISVGALTKHVQALDLSMRFS