Protein Info for HGI48_RS17505 in Dickeya dianthicola 67-19

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 63 to 91 (29 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 90 to 258 (169 residues), 51.5 bits, see alignment E=5.3e-18

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 97% identity to ddd:Dda3937_04077)

Predicted SEED Role

"Thiamin ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RHE9 at UniProt or InterPro

Protein Sequence (260 amino acids)

>HGI48_RS17505 ABC transporter permease (Dickeya dianthicola 67-19)
MSRAERRYHLLVVWLILLILMLPLLATLGYALATEWGATILPRGLTLKWFTELWSDNRFL
LALGRSLLICFGALLFSLLLVLPAMFVIAWAFPKLDGLMNVLILLPFAVPPVVSSVGLLQ
LYSAEPLALTGTPWILVGCYFTIALPFIYRAIANNMQAINLQELLDAAHLLGASTWQAAL
WVVLPNLRKGVMIAVLLSFSFLIGEFVFANLLAGTNYETLQVYLYNKRNDSGHFTSALVI
AYFLVVLLVTWLANALNRNQ