Protein Info for HGI48_RS17265 in Dickeya dianthicola 67-19

Annotation: DUF488 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 PF04343: DUF488" amino acids 8 to 114 (107 residues), 88.1 bits, see alignment E=3.6e-29

Best Hits

Swiss-Prot: 44% identical to YEAO_ECOLI: Uncharacterized protein YeaO (yeaO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to ddd:Dda3937_00465)

Predicted SEED Role

"probable uroporphyrin-III c-methyltransferase (EC 2.1.1.107)" (EC 2.1.1.107)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.107

Use Curated BLAST to search for 2.1.1.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RGS6 at UniProt or InterPro

Protein Sequence (124 amino acids)

>HGI48_RS17265 DUF488 family protein (Dickeya dianthicola 67-19)
MSEPVQLMRVYDAQPPFSFPTFLVDRLWPRGIAKSRLPGVVWLKDVAPNHELRRWFHANP
VQWETFVGMYRAELSQHTAWQPLVALLRQSPPITLLYGSRDTERNHAMVLRDFLIEQAAL
SECG