Protein Info for HGI48_RS17265 in Dickeya dianthicola 67-19

Annotation: DUF488 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04343: DUF488
  • amino acids 8 to 114 (107 residues), 88.1 bits, E=3.6e-29

Best Hits

Swiss-Prot: 44% identical to YEAO_ECOLI: Uncharacterized protein YeaO (yeaO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to ddd:Dda3937_00465)

Predicted SEED Role

"probable uroporphyrin-III c-methyltransferase (EC 2.1.1.107)" (EC 2.1.1.107)

MetaCyc Pathways

• siroheme biosynthesis (4/4 steps found)
• factor 430 biosynthesis (3/7 steps found)
• cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (2/13 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (3/15 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (13/33 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (12/36 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.107

Use Curated BLAST to search for 2.1.1.107

Sequence Analysis Tools

See A0A7L9RGS6 at UniProt or InterPro

Protein Sequence (124 amino acids)

>HGI48_RS17265 DUF488 family protein (Dickeya dianthicola 67-19)
MSEPVQLMRVYDAQPPFSFPTFLVDRLWPRGIAKSRLPGVVWLKDVAPNHELRRWFHANP
VQWETFVGMYRAELSQHTAWQPLVALLRQSPPITLLYGSRDTERNHAMVLRDFLIEQAAL
SECG