Protein Info for HGI48_RS17245 in Dickeya dianthicola 67-19

Annotation: iron-sulfur cluster repair protein YtfE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF04405: ScdA_N" amino acids 5 to 56 (52 residues), 64 bits, see alignment E=7.8e-22 TIGR03652: iron-sulfur cluster repair di-iron protein" amino acids 8 to 217 (210 residues), 261.9 bits, see alignment E=2.5e-82 PF01814: Hemerythrin" amino acids 79 to 217 (139 residues), 91.1 bits, see alignment E=8.1e-30

Best Hits

Swiss-Prot: 90% identical to YTFE_DICC1: Iron-sulfur cluster repair protein YtfE (ytfE) from Dickeya chrysanthemi (strain Ech1591)

KEGG orthology group: K07322, regulator of cell morphogenesis and NO signaling (inferred from 96% identity to ddd:Dda3937_04394)

MetaCyc: 67% identical to iron-sulfur cluster repair protein YtfE (Escherichia coli K-12 substr. MG1655)
1.7.99.-

Predicted SEED Role

"Nitric oxide-dependent regulator DnrN or NorA" in subsystem Nitrosative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RGR4 at UniProt or InterPro

Protein Sequence (221 amino acids)

>HGI48_RS17245 iron-sulfur cluster repair protein YtfE (Dickeya dianthicola 67-19)
MHYRDQPLGELAITIPRATALFREFNLDFCCGGKQTLLRAAGKQALDIDMLESRLAILAA
QPSTEKDWQQASLGEIIQHIVSRFHDRHREQLPELIRMAEKVERVHHDKPACPHGLTNQL
MLIHDDLAQHMMKEERILFPMIQSGMGAQAGGPISMMEHEHDDAGQQLEVVKTITNDVTP
PDNACTTWRALYTGINEFIDDLMEHIHLENNQLFPRALRGE