Protein Info for HGI48_RS17120 in Dickeya dianthicola 67-19

Annotation: PAS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 transmembrane" amino acids 143 to 163 (21 residues), see Phobius details amino acids 172 to 202 (31 residues), see Phobius details PF00989: PAS" amino acids 13 to 109 (97 residues), 41.4 bits, see alignment E=3.4e-14 TIGR00229: PAS domain S-box protein" amino acids 15 to 117 (103 residues), 43.9 bits, see alignment E=1.2e-15 PF13426: PAS_9" amino acids 23 to 111 (89 residues), 37.6 bits, see alignment E=5.8e-13 PF08447: PAS_3" amino acids 31 to 113 (83 residues), 49.9 bits, see alignment E=8.2e-17 PF00672: HAMP" amino acids 207 to 258 (52 residues), 24.8 bits, see alignment 5.5e-09 PF00015: MCPsignal" amino acids 322 to 478 (157 residues), 162.4 bits, see alignment E=2.3e-51

Best Hits

KEGG orthology group: K03776, aerotaxis receptor (inferred from 96% identity to ddd:Dda3937_00184)

Predicted SEED Role

"Aerotaxis sensor receptor protein" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RGR9 at UniProt or InterPro

Protein Sequence (511 amino acids)

>HGI48_RS17120 PAS domain-containing protein (Dickeya dianthicola 67-19)
MRVNAPITQQEYLLDDNTTLMSTTDVKSHITYANSAFIRVSGFDEHELMGTPHNIVRHPD
MPIEAFADMWYTLQQGDSWTGLVKNRRKNGDHYWVRANVTPVYHHNQLAGYISVRNTPKA
EEIQAAEPLYEAVLSKQVRHIRFYKGLVVRTGLLSVLSLFQRLSVRSRLRLAVLFGGLVP
LALILLGCGATTSIVATLLLMVTLDRFLQRQIAHPLRLILRQAQQVVSGRRADSIHINRV
DDIGLLLRVVNQFGLNLHSLVDDVGTQVAGINSVSRQLADSNGDLSARTEETSANLQQTA
AAIEQITVAVQQSADTATQATQMAQNASLSASKGGDIMAEAVGMMEAISNASRKIVDIIG
VIDSIAFQTNILALNAAVEAARAGVEGRGFAVVAAEVRSLAQHSASAAREIKTLIDANMT
SVENGSALVDKAGLHIQDIVNDVQQVAAMISEISNATHEQTAALSLINDSIAQIEQMTVG
NTGMVDQSAEFATDLGRQALRLTDAINVYGK