Protein Info for HGI48_RS17075 in Dickeya dianthicola 67-19

Annotation: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01938: TRAM
  • amino acids 11 to 66 (56 residues), 45.8 bits, 1.8e-15
• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 24 to 442 (419 residues), 440.6 bits, E=3.1e-136
• PF05958: tRNA_U5-meth_tr
  • amino acids 280 to 445 (166 residues), 76.9 bits, E=6.4e-25
• PF01135: PCMT
  • amino acids 291 to 360 (70 residues), 24.6 bits, E=7.9e-09
• PF05175: MTS
  • amino acids 299 to 381 (83 residues), 23 bits, E=2.1e-08
• PF13847: Methyltransf_31
  • amino acids 305 to 381 (77 residues), 43.3 bits, E=1.3e-14
• PF13649: Methyltransf_25
  • amino acids 308 to 363 (56 residues), 33.9 bits, 1.7e-11

Best Hits

Swiss-Prot: 71% identical to RLMD_PECCP: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 71% identity to pct:PC1_3390)

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A0A7L9RGN3 at UniProt or InterPro

Protein Sequence (456 amino acids)

>HGI48_RS17075 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (Dickeya dianthicola 67-19)
MAQFYSPNRRVTTRQTLTVTANDLDPFGQGVARHQGKTLFIPGVLPGEQAEVQLTEEKRQ
FAHARLRRLLTTSEERVTPRCPHFSVCGGCQQQHASQPLQQRSKAAALTHLMTRETGAVP
PEPEVIAESAYAYRRRARLALYYQAKTQAKTQSKTQAKTHRLQMGYRQAGSHDLVDIAAC
PILCPELEALLAPLRDCLGQLQAVRRLGHVELVLAEQGPLVVLRHLDPLRDADRQALTAF
AVLHGTALFSAPEAGALECLHGDMPSYRIAGLSLAFSPRDFIQVNDGINQRMVEQALTWL
DPQPQDRVLDLFCGMGNFTLPLAARAGSVVGVEGVAALVDKGRENARRNGLTQVTFYHHD
LEADVTRQPWAAMGFDKILLDPARAGASGVMPQIVKLAPRRVVYISCNPTTLARDSKVLM
AAGYRLARLAMLDMFPHTGHLESMALFLLGSDGSVK