Protein Info for HGI48_RS16830 in Dickeya dianthicola 67-19

Annotation: multidrug efflux MFS transporter periplasmic adaptor subunit EmrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details TIGR00998: efflux pump membrane protein" amino acids 21 to 346 (326 residues), 438.1 bits, see alignment E=1.9e-135 PF16576: HlyD_D23" amino acids 62 to 290 (229 residues), 47.4 bits, see alignment E=2.9e-16 PF13533: Biotin_lipoyl_2" amino acids 62 to 108 (47 residues), 35.3 bits, see alignment 1.6e-12 PF00529: CusB_dom_1" amino acids 92 to 347 (256 residues), 60.5 bits, see alignment E=2.5e-20 PF13437: HlyD_3" amino acids 219 to 294 (76 residues), 44.6 bits, see alignment E=4e-15

Best Hits

Swiss-Prot: 67% identical to EMRA_ECOLI: Multidrug export protein EmrA (emrA) from Escherichia coli (strain K12)

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 95% identity to ddd:Dda3937_00893)

MetaCyc: 67% identical to multidrug efflux pump membrane fusion protein EmrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RH29 at UniProt or InterPro

Protein Sequence (391 amino acids)

>HGI48_RS16830 multidrug efflux MFS transporter periplasmic adaptor subunit EmrA (Dickeya dianthicola 67-19)
MNANVEKQTPPTMPSKSKKSRKGILTLLMILFFFIGCVWFAYWYLVLRHHQETDDAYVAG
NQIQIMSQVNGSVARVNVDNTDLVRKGDVLVELDPTDAEQAFERAKTTLANSVRQVHQQM
ITVRQYQANIDLQQIALDTAISDLIRREALGRANAIGREDLQHARDQVASARASLEAAKQ
QYAATQALVLNTPLEQQPAIAQAATDLRNAWLALKRTHIVSPVDGYVSRRSVQLGARVTP
SSALMAVVPTAPLWVDANFKETQLPNMRIGQPATIISDLYGDIVEYKGKVVGLDMGTGSA
FSLLPAQNATGNWIKVVQRLPVRIELDPKQLADYPLRIGLSMLVNVDTANADGKVLSDAS
RATPAYQSDALDLDLAPVNQMIDQIIGANAG