Protein Info for HGI48_RS16420 in Dickeya dianthicola 67-19

Annotation: phophatidylserine decarboxylase associated domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 PF12588: PSDC" amino acids 73 to 218 (146 residues), 109.2 bits, see alignment E=1.8e-35 PF02666: PS_Dcarbxylase" amino acids 239 to 438 (200 residues), 89 bits, see alignment E=3.4e-29

Best Hits

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 97% identity to dze:Dd1591_0966)

Predicted SEED Role

"FIG00613581: hypothetical protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.65

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RGM6 at UniProt or InterPro

Protein Sequence (474 amino acids)

>HGI48_RS16420 phophatidylserine decarboxylase associated domain-containing protein (Dickeya dianthicola 67-19)
MTHTKSHTASTPEAEPSPHYESSGHSLLTLDNAGPIQMGFWVPNRVWATAKFLIPLREHI
ANKKQANTLTPMQPVLQNVKNWVTNHSVYRMWLNSMIEQSNAYVASLPESTRKEISDDGD
VIWIDDYDSFFEILNEIITTSPSFNTTAQVGTPMNAFLAVAMGTEAGVALFHDATFNQQF
RQVLDAWNSFLKSSASLDKLDIAQPEKPGSWIAKGAYQAGVWHQMQHDPNLPGYGFASWN
DFFIRQFVPGARPFQGDPNTQVDIGCETTPWRHADQLQLESRFWVKDIPYSLLDLFGGQR
QWAKLFEGGQLYQGFLSATHYHRWNAPLDGFLVRSWVEPGTYFAQRPGQGEDQGTWEGTE
SQPYLGHVAARAVFIFRHKTCGYVALICIGMVEVSSCVIEPSTFIVEESAEPVGITRGVE
IGHFEFGGSTHMMIFQKDRVALEKWAIDAARHRNDQNPVPLGSVIATALDSKGQ