Protein Info for HGI48_RS16360 in Dickeya dianthicola 67-19

Annotation: nicotinamide-nucleotide amidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02464: CinA
  • amino acids 10 to 159 (150 residues), 197.7 bits, E=4.5e-63
• TIGR00199: amidohydrolase, PncC family
  • amino acids 13 to 160 (148 residues), 192.6 bits, E=1.9e-61

Best Hits

Swiss-Prot: 62% identical to PNCC_ECOLI: Nicotinamide-nucleotide amidohydrolase PncC (pncC) from Escherichia coli (strain K12)

KEGG orthology group: K03743, (no description) (inferred from 94% identity to ddd:Dda3937_03155)

MetaCyc: 62% identical to NMN aminohydrolase (Escherichia coli K-12 substr. MG1655)
Nicotinamide-nucleotide amidase. [EC: 3.5.1.42]

Predicted SEED Role

"C-terminal domain of CinA paralog, YdeJ"

MetaCyc Pathways

• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.42

Sequence Analysis Tools

See A0A7L9RGB8 at UniProt or InterPro

Protein Sequence (162 amino acids)

>HGI48_RS16360 nicotinamide-nucleotide amidase (Dickeya dianthicola 67-19)
MTETEVLRLSVLVGERLKARQAKMTCAESCTGGWLAKAITDVPGSSAWFDYGFVTYSNQA
KQALIGVRANTLAQCGAVSRDVVNEMAVGALSRSGADIAVSVSGIAGPDGGTPDKPVGTV
WFGFSDKNGNSVAQRMQFDGDRHDVRLQAVAFALRTLLERFL