Protein Info for HGI48_RS16295 in Dickeya dianthicola 67-19

Annotation: inner membrane protein YpjD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 126 to 152 (27 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 209 to 226 (18 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 37 to 261 (225 residues), 142.2 bits, see alignment E=9.1e-46

Best Hits

Swiss-Prot: 71% identical to YPJD_ECOLI: Inner membrane protein YpjD (ypjD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to ddd:Dda3937_03942)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C230 at UniProt or InterPro

Protein Sequence (264 amino acids)

>HGI48_RS16295 inner membrane protein YpjD (Dickeya dianthicola 67-19)
MSVFAIVALAAYFLSLGLIIPSLVRKNGAYRRLAVVSATIALVCHAVALYQRIFDVQIGQ
NLSLLNIGSLISLIICTVMTIVASRNRGWFLLPIIYAFAFINLAFASFMPGEFITHLEAM
PGLMVHIGLALFAYATLMIAALYALQLALLDYMLKTKKLGFAADMPPLLGIERKMFHITQ
IGVILLTLTLCTGLIYMNDLLSNKENLHKALFSLLAWFVYILLLWGHYHEGWRGRRVVWF
NLIGALLLTLSYFGSRVIQNFLAH