Protein Info for HGI48_RS16015 in Dickeya dianthicola 67-19

Annotation: vitamin B12 ABC transporter substrate-binding protein BtuF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01497: Peripla_BP_2" amino acids 29 to 222 (194 residues), 79.9 bits, see alignment E=1e-26

Best Hits

Swiss-Prot: 66% identical to BTUF_PECAS: Vitamin B12-binding protein (btuF) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K06858, vitamin B12 transport system substrate-binding protein (inferred from 94% identity to ddd:Dda3937_00499)

MetaCyc: 51% identical to vitamin B12 ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-5-RXN [EC: 7.6.2.8]; 7.6.2.8 [EC: 7.6.2.8]

Predicted SEED Role

"Vitamin B12 ABC transporter, B12-binding component BtuF" in subsystem Coenzyme B12 biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RG56 at UniProt or InterPro

Protein Sequence (276 amino acids)

>HGI48_RS16015 vitamin B12 ABC transporter substrate-binding protein BtuF (Dickeya dianthicola 67-19)
MKSVYFPILWLLTLLWLPLCRAEPVAQRVVSLAPHATEMAFAAGLGERLVGVSAWSNYPP
EAERIEQVANWQGINLERILALKPDLVLAWREGNAQRPLEQLASFGIRILYLDPATLDDI
PRQLERLAQYSPHPEQAREAAQRFRQQQQTLAQQYGHSTPVRVFLQFGSQPLFTSSRATL
QSQVVSLCGGDNVFADSPVPWPQVSREQVIRRQPQVIVISGPPGAAEQVNAFWQPQLTPA
VIAVNEDWFSRTGPRLMLAAEQLCRQFAAWRPVGNR