Protein Info for HGI48_RS15775 in Dickeya dianthicola 67-19

Annotation: type I secretion system permease/ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 728 transmembrane" amino acids 181 to 203 (23 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 288 to 311 (24 residues), see Phobius details amino acids 316 to 334 (19 residues), see Phobius details amino acids 398 to 424 (27 residues), see Phobius details amino acids 430 to 450 (21 residues), see Phobius details TIGR03375: type I secretion system ATPase" amino acids 29 to 723 (695 residues), 879 bits, see alignment E=1.2e-268 PF00664: ABC_membrane" amino acids 182 to 441 (260 residues), 86.7 bits, see alignment E=2.2e-28 PF00005: ABC_tran" amino acids 512 to 659 (148 residues), 105.1 bits, see alignment E=5.1e-34

Best Hits

KEGG orthology group: K12541, ATP-binding cassette, subfamily C, bacterial LapB (inferred from 92% identity to ddd:Dda3937_03386)

Predicted SEED Role

"Type I secretion system ATPase, LssB family LapB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RG22 at UniProt or InterPro

Protein Sequence (728 amino acids)

>HGI48_RS15775 type I secretion system permease/ATPase (Dickeya dianthicola 67-19)
MNTHHEQPPGDEEYHHSPQHQDPRIRHDDPLLDSLLVLCRLQGKPTSRATLTAGLPLEDL
RLPASLLPRAAARAGLRARILKRSLNAIPAMSLPAMLLLREGRAAVLLGWTADGSARLMT
GETEGGEITVDHNTLQQNYLGLVMFAQSAHRFEAPPATLLPRSKTWLWDTLKLSRSLHLD
AVVASLLINTIALFVPLFIMQVYDRVIPNQTTTTLWMLASGVGIALLFDFVLRILRSICV
DIAGKKTDLILSASLFERLTGMMLSAFPARTGAVTHRVREFQALRDTLSSLTLGTLIDFP
FTLLTLVLLAMLGGSLVWIPLLTLPLVVLSNWLLQKPMRAVQAHSRRLNDERQALLTETL
AGLDAIKINNAQGERQRQWEQLSGDISRLDSRVKTLSAIAIHLTQSCQHLAGIVVMVSGV
YLLLDNQLTLGTLFACYLINNQALITLGPLSELFTRYQQARLTLEETRRLMELPQERGEQ
PYPLKRESIQGSIEFRDVTFRYPEQKNRALIDINLSIQPGEKIGIIGRTGSGKSSLEKLI
ANLYQPTNGNLLVDGVDARQLDIADVRHHIGYVPQDIQLFNGTLRDNLICGARYVEDDAM
LRVADIAGVNDFARLHPDGYNLQVGERGMQLSGGQRQAVAIARALLLDPPILVMDEPTSA
MDNSSEDRFKQALQTYIANRTLLLVTHRVSMLTLVDRLVIVDKGRIIADGPKAIVLDALK
KGQINASR