Protein Info for HGI48_RS15620 in Dickeya dianthicola 67-19

Annotation: ISC system 2Fe-2S type ferredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 TIGR02007: ferredoxin, 2Fe-2S type, ISC system" amino acids 2 to 111 (110 residues), 206.4 bits, see alignment E=3.9e-66 PF00111: Fer2" amino acids 13 to 91 (79 residues), 54.2 bits, see alignment E=5.9e-19

Best Hits

Swiss-Prot: 92% identical to FER_ECO57: 2Fe-2S ferredoxin (fdx) from Escherichia coli O157:H7

KEGG orthology group: K04755, ferredoxin, 2Fe-2S (inferred from 92% identity to ecf:ECH74115_3756)

MetaCyc: 92% identical to reduced ferredoxin (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Ferredoxin, 2Fe-2S" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RFZ2 at UniProt or InterPro

Protein Sequence (111 amino acids)

>HGI48_RS15620 ISC system 2Fe-2S type ferredoxin (Dickeya dianthicola 67-19)
MPKIVFLPHQDLCPEGVVLEANSGETILDVALRNGIEIEHACEKSCACTTCHCIVREGFD
SLAESTEDEDDMLDKAWGLEPESRLGCQARVADEDLVVEIPRYTINHAREH