Protein Info for HGI48_RS15470 in Dickeya dianthicola 67-19

Annotation: type II secretion system minor pseudopilin GspI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 29 to 30 (2 residues), see Phobius details TIGR01707: type II secretion system protein I" amino acids 9 to 106 (98 residues), 46.4 bits, see alignment E=2.2e-16 PF02501: T2SSI" amino acids 45 to 118 (74 residues), 55.3 bits, see alignment E=3e-19

Best Hits

KEGG orthology group: K02458, general secretion pathway protein I (inferred from 75% identity to ddd:Dda3937_04113)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RGD2 at UniProt or InterPro

Protein Sequence (122 amino acids)

>HGI48_RS15470 type II secretion system minor pseudopilin GspI (Dickeya dianthicola 67-19)
MTNNKKASGIVLLEVLIAVLILALCSGAILRAFSQEMALTAHTREAIIAGWVADNLLVLA
HLTPLPASGEPVSGSSIMGNQRWRWELGYTQETESSGIRLLQVRVFNATQPQPLVQLNIT
PP