Protein Info for HGI48_RS15460 in Dickeya dianthicola 67-19

Annotation: type II secretion system F family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 129 to 148 (20 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 366 to 391 (26 residues), see Phobius details PF00482: T2SSF" amino acids 69 to 191 (123 residues), 101.8 bits, see alignment E=1.3e-33 amino acids 272 to 392 (121 residues), 66.7 bits, see alignment E=1e-22

Best Hits

Swiss-Prot: 46% identical to GSPF_PECCC: Type II secretion system protein F (outF) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: None (inferred from 90% identity to dze:Dd1591_3313)

Predicted SEED Role

"General secretion pathway protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RJM2 at UniProt or InterPro

Protein Sequence (401 amino acids)

>HGI48_RS15460 type II secretion system F family protein (Dickeya dianthicola 67-19)
MRNFRYTAVNTEGELVTGRHRAFSTESLREQLFARQLIMVSCRASLLQQWLRLLSRHERL
STLDLALLTRQLASLLEAGIPLEEALMTLASQADKHAVGAVLNAVREQLIAGLSFAQALQ
TLPYNFNRLYCAMVAAGEATGCLALVLIRLADYLDQHQKTKNALIQALLYPVLLAVMSVI
VVSILLSSVVPQVVMQLQQTHTPLPLTTRTLLAISDVLNHYGWMLPVALAALAVGLHQIV
RIPARKLWLDRHLLRLCAVGPLLRDISSARYIRTMEILIASAIPLLESMSVAENVLNNSF
ARFQLTVASQQVNEGKSLTESLSNNDIFSGMVKHMIASGERSGRLEPMLKYIADIQEDSL
KRRISLLLLLGENGLLIIISSLVLFIVMSILQPIMQLSNTI