Protein Info for HGI48_RS15320 in Dickeya dianthicola 67-19

Annotation: porin OmpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13505: OMP_b-brl" amino acids 8 to 193 (186 residues), 79.8 bits, see alignment E=4.3e-26 PF01389: OmpA_membrane" amino acids 23 to 196 (174 residues), 230.2 bits, see alignment E=2.4e-72 PF00691: OmpA" amino acids 230 to 324 (95 residues), 76.9 bits, see alignment E=2e-25

Best Hits

Swiss-Prot: 77% identical to OMPA_SALTY: Outer membrane protein A (ompA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03286, OmpA-OmpF porin, OOP family (inferred from 96% identity to dze:Dd1591_1209)

Predicted SEED Role

"Outer membrane protein A precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RFU3 at UniProt or InterPro

Protein Sequence (354 amino acids)

>HGI48_RS15320 porin OmpA (Dickeya dianthicola 67-19)
MKKTAIAIAVALAGFATVAQAAPNDNTWYAGGKLGWSQYHDTGLTGNGYNVTNAAQSQLG
AGAFGGYQANPYLGFEMGYDWLGRMKYNGGNQGSFKAQGVQLAAKLSYPIVDDLDIYTRL
GGFVWRADSHDNTGLNDHDTGVSPLAAVGVEYAITKNWATRLDYQWVNNIGDASTVGGRP
DNGLLSVGVSYRFGQETAAPAPIIAAAPAPTPAPAPVVQTKRFTLKSDVLFNFNKATLKP
EGQRSLDQLYSQLSTLDPKDGSVVVLGFTDRLGSDQYNQTLSTKRAQTVVDYLVHKGIPS
NKISARGMGKANPVSGSTCVNVKARAALIDCLAPDRRVEIEVKGIKDVVTQPQA