Protein Info for HGI48_RS15275 in Dickeya dianthicola 67-19

Annotation: heat shock protein HspQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 TIGR02097: hemimethylated DNA binding domain" amino acids 4 to 100 (97 residues), 100.2 bits, see alignment E=3.5e-33 PF08755: YccV-like" amino acids 5 to 99 (95 residues), 74.1 bits, see alignment E=4.9e-25

Best Hits

Swiss-Prot: 69% identical to HSPQ_PECCP: Heat shock protein HspQ (hspQ) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K11940, heat shock protein HspQ (inferred from 92% identity to ddd:Dda3937_01701)

Predicted SEED Role

"hemimethylated DNA binding protein YccV"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DJI3 at UniProt or InterPro

Protein Sequence (107 amino acids)

>HGI48_RS15275 heat shock protein HspQ (Dickeya dianthicola 67-19)
MINCKFTIGQQIRHKLLGYPGVVIDIDPEYSLEQPKWEELAVNDTLRTAPWYHVVMEDGQ
GRPIHTYLAEAQLVEAQRVNEDPNLSEHPSLDELAATIRRRAPRLLH