Protein Info for HGI48_RS15220 in Dickeya dianthicola 67-19

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 718 transmembrane" amino acids 24 to 48 (25 residues), see Phobius details amino acids 423 to 446 (24 residues), see Phobius details amino acids 457 to 477 (21 residues), see Phobius details amino acids 483 to 505 (23 residues), see Phobius details amino acids 517 to 543 (27 residues), see Phobius details amino acids 565 to 588 (24 residues), see Phobius details amino acids 610 to 633 (24 residues), see Phobius details amino acids 679 to 702 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 502 to 709 (208 residues), 55.6 bits, see alignment E=3.1e-19

Best Hits

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 93% identity to ddd:Dda3937_01690)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RFS5 at UniProt or InterPro

Protein Sequence (718 amino acids)

>HGI48_RS15220 ABC transporter permease subunit (Dickeya dianthicola 67-19)
MADTGNLPYRDRQRALIDRLTRRIVVGSGWLVLLALLLIFFYLLYVVIPLFSSASIRPLA
PVAVDTREPALALGISDNGRWAFRVDAAGYGEFTALDRGQSIARVPLAPAVTQAAMSMGE
RPLLVLGQADGALSVVRPEMPLSGTGAPAWRYPLGERPLLPAGAAAPLRQLAVAESGDVP
RVAMISGDNQLQLYALTAAGAQSVGQVTLAEPTEQLLLTPDGQQLYTLSGNHLTVWQPSE
QALTARETVTLPGAAPLSLSLLAGGHSLLVKSADGRVSQWFDTPAAQGPRLSEIRTFPTV
GRQLQLVTEPRRRVFATLDPQGHFSLFASKQSGELMSALLAPQARLAAFSPRGRALLVET
DAGWQPYQLDNAYPDIGWRGLWQKLWYENYPEPDYVWQPTAADDSYQAKFSLVPLLTGTF
NAALYAMLFAAPLALAAAIYTACFMAPALRRWVKPAMEIMGALPTVVIGLIAALWLAPQM
AAYLAAILLLPPLWAVAVLGCGWLLEQLPERWRGGVLAGWDALLLIPAMLLILALVCWLG
PWLEMRLLGQPLWQWMGDHFSQRNTLVAGVALGFALIPLIFSLAEDALFSVPARLSQGSL
ALGATAWQTLWRVVLPSASSGIFAALMLSFGRAVGETMIVLMATGNTPVMNNSLFQGLRS
LAANIAIEMPEAAMSSAHYRVLFLAALVLFVFTFVVNSLAEVIRQRLRRRYRDEGELS