Protein Info for HGI48_RS15115 in Dickeya dianthicola 67-19

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 127 to 141 (15 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 194 to 217 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 13 to 117 (105 residues), 68.4 bits, see alignment E=3.3e-23 PF00528: BPD_transp_1" amino acids 40 to 222 (183 residues), 69.4 bits, see alignment E=1.8e-23

Best Hits

Swiss-Prot: 58% identical to OCCM_RHIRD: Octopine transport system permease protein OccM (occM) from Rhizobium radiobacter

KEGG orthology group: K10019, octopine/nopaline transport system permease protein (inferred from 94% identity to ddd:Dda3937_01669)

Predicted SEED Role

"ABC-type arginine/histidine transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RFY7 at UniProt or InterPro

Protein Sequence (238 amino acids)

>HGI48_RS15115 ABC transporter permease subunit (Dickeya dianthicola 67-19)
MIDIAFLTQTFLRLLSALPVTLGLFFSSFAVGAVLSVLLVAMRVSRIWPLSGFARLYMLV
FRGTPLLIQLFLVYYGLGQFSVVRDSLFWPVLRDPFSCAVAALALCTAGYTAEILRGALL
SVPAGQIEAGLACGMSRWLLLRRIIAPVALRHALPAWSTEAILLIKSTALASLVTVWDVT
GVAQQVIQRTYRSLEVFVCAALIYLLLNFIIVRVFAWLERALSPNLAAVPTSSGREHE