Protein Info for HGI48_RS15020 in Dickeya dianthicola 67-19

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 96 to 269 (174 residues), 65.9 bits, see alignment E=2.1e-22

Best Hits

Swiss-Prot: 67% identical to GANQ_BACSU: Putative arabinogalactan oligomer transport system permease protein GanQ (ganQ) from Bacillus subtilis (strain 168)

KEGG orthology group: K10110, maltose/maltodextrin transport system permease protein (inferred from 98% identity to dze:Dd1591_1278)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RJK8 at UniProt or InterPro

Protein Sequence (277 amino acids)

>HGI48_RS15020 ABC transporter permease subunit (Dickeya dianthicola 67-19)
MKRERAIRLSLSWLVIIAVSVVIIYPLVWTVGASLNAGNSLLSTSIIPDNPSFQHYASLF
NGQVNYLTWYWNSMKISFLTMVLTLLSVSFTAYAFSRFRFKGRQNGLMLFLLLQMIPQFS
ALIAIFVLSQLLGLINSHLALVLIYVAGMIPMNTYLMKGYLDAIPRELDESARMDGAGNF
RIFIEIIIPLSKPIIAVVALFSFTGPLGDFILSSTILRTPDKYTLPIGLYNLVAQKMGAS
YTTYAAGAVLIAVPVALLYLMLQKYFVSGLTSGSTKG