Protein Info for HGI48_RS13815 in Dickeya dianthicola 67-19

Annotation: D-serine/D-alanine/glycine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 26 to 43 (18 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 103 to 128 (26 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details amino acids 369 to 394 (26 residues), see Phobius details amino acids 414 to 433 (20 residues), see Phobius details amino acids 439 to 458 (20 residues), see Phobius details PF00324: AA_permease" amino acids 25 to 464 (440 residues), 411 bits, see alignment E=6.7e-127 PF13520: AA_permease_2" amino acids 29 to 449 (421 residues), 139.8 bits, see alignment E=1.3e-44

Best Hits

Swiss-Prot: 76% identical to CYCA_ECOLI: D-serine/D-alanine/glycine transporter (cycA) from Escherichia coli (strain K12)

KEGG orthology group: K11737, D-serine/D-alanine/glycine transporter (inferred from 97% identity to ddd:Dda3937_03962)

MetaCyc: 76% identical to D-serine/alanine/glycine:H+symporter (Escherichia coli K-12 substr. MG1655)
RXN0-5130; RXN0-5201; RXN0-5202; RXN0-5203; TRANS-RXN-62A; TRANS-RXN-62B

Predicted SEED Role

"D-serine/D-alanine/glycine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RF65 at UniProt or InterPro

Protein Sequence (467 amino acids)

>HGI48_RS13815 D-serine/D-alanine/glycine transporter (Dickeya dianthicola 67-19)
MTEQTHHIPDTTGHSDLRRNLTNRHIQLIAIGGAIGTGLFMGSGKTISLAGPSIIFVYMI
IGFMLFFVMRAMGELLLSNLNYKSFSDFAADLLGPWAGFFTGWTYWFCWVVTGIADVVAI
SAYAQFWFPDLSQWLSSLLCVLLLLTLNLATVKLFGEMEFWFAMIKIIAIVALIVIGAAL
VIMQFTSPSGAVASVTNLWQDGGLFPKGLSGFFAGFQIAVFAFVGIELVGTTAAETKNPT
VVLPRAINAIPIRIIMFYVFALIMIMSVTPWNHIAADRSPFVEMFVLVGLPAAASVINFV
VLTSAASSANSGVFSTSRMLFGLARQGDAPARFGRLSKRAVPSTGLLFSCLCLLSGVVLI
YLIPNVMTVFTLVTTVSAILFMFVWSIILCSYLVYRRNRPQLHQTSSYKMPWGIVMSWVC
LAFFAFVVVLLTLQPDTLQALMVTPVWFVVLAIAYQFIRRRRARALA