Protein Info for HGI48_RS13760 in Dickeya dianthicola 67-19

Annotation: poly(3-hydroxyalkanoate) depolymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF00109: ketoacyl-synt" amino acids 3 to 253 (251 residues), 80.3 bits, see alignment E=1.8e-26 PF02801: Ketoacyl-synt_C" amino acids 275 to 375 (101 residues), 97.5 bits, see alignment E=5.3e-32

Best Hits

KEGG orthology group: K00646, malonyl-ACP decarboxylase (inferred from 92% identity to dda:Dd703_1419)

MetaCyc: 48% identical to malonyl-[acp] decarboxylase (Corallococcus coralloides)
4.1.1.aj [EC: 4.1.1.aj]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASII (EC 2.3.1.179)" (EC 2.3.1.179)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.179

Use Curated BLAST to search for 2.3.1.179 or 4.1.1.aj

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RF11 at UniProt or InterPro

Protein Sequence (418 amino acids)

>HGI48_RS13760 poly(3-hydroxyalkanoate) depolymerase (Dickeya dianthicola 67-19)
MKNNVVVTGLGVTAANGIGIPAFTQSLKTGISGINRHTNEFPEIKASLADYNYKAAVESL
SLTQEALKEALRLGARVPLSTRVSLATALEAWLDAFADGCPYPPEQRGIIIAGHNVEQKY
QYQIRQSFIDQPEFVPASYALYFMDTNQLGLLSELLTIRGEGCTVGGASASGNSGIIQAY
RQIASGITQSCLVVGAMADLSPPEIQAFKNSGALLTQSDVSDPAQLCRPFDQDRNGFVYG
QGCACLLLENEQSARERHAPIWGRILGGSICLDANRGSNPSCEGESRVMQQALLTARCPY
DSVDYINTHGTSSLMGDETEIAAIKHVFGPYHQQIWLNSTKSLTGHCLYAAAAVETVATL
IQMKERFLHPNLNLEKPINNECRFVGQHAQSQEINVALNNAFGFGGINTCVVLEHVSQ