Protein Info for HGI48_RS13410 in Dickeya dianthicola 67-19

Annotation: flagellar M-ring protein FliF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 476 to 495 (20 residues), see Phobius details TIGR00206: flagellar M-ring protein FliF" amino acids 15 to 575 (561 residues), 579.4 bits, see alignment E=4.9e-178 PF01514: YscJ_FliF" amino acids 50 to 223 (174 residues), 226.4 bits, see alignment E=2.3e-71 PF08345: YscJ_FliF_C" amino acids 255 to 455 (201 residues), 138.6 bits, see alignment E=2.2e-44

Best Hits

Swiss-Prot: 61% identical to FLIF_SALTY: Flagellar M-ring protein (fliF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02409, flagellar M-ring protein FliF (inferred from 96% identity to ddd:Dda3937_02226)

Predicted SEED Role

"Flagellar M-ring protein FliF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9REW5 at UniProt or InterPro

Protein Sequence (576 amino acids)

>HGI48_RS13410 flagellar M-ring protein FliF (Dickeya dianthicola 67-19)
MNALTSGAATGGKSFGEILNRLRANPRIPLLIASAATIAIVIALSLWARGPDYRVLYTNI
NERDGGSIVSELGKMNIPYRFTENGAAIMIPSDKVYETRLKLAQQGLPKGGAVGFELLDQ
EKFGISQFSEQINYQRALEGELARTMETLGPIHNARVHLAIPKPSLFVREQKSPSAAVTV
TLQPGRALDDSQISAITYLVSSSVAGLPADKVTVVDQTGKLLTQNDSSGRDLNASQLKYA
NEVESNYQRRIEAILAPVVGAGNVHAQVTAQIDFASREQTDEQYQPNQTPNQAAVRSQQN
SQSDQRGGPNVGGVPGALSNTPTPAPTAPISTPPANNANNANNANNANNANNANANTTGT
NTQTSAGNAANQTYNSRHDQTINYEVDRTIRHTKQNTGNIQRLSVAVVVNYTQGEDGKPA
ALNDDQLKKIEALVRESMGFSSDRGDTLNVVNTPFTITDATGGELPFWQKQAFFDLLTEA
GRWLLVLIVGWILYRKLVRPQLQRRAQVQEAAEAAASLRGQDADVTVTINSMEEELQRKS
EQRAHAEMHSQRIRDLAENDPRVVALVIRHWMSNEL