Protein Info for HGI48_RS13325 in Dickeya dianthicola 67-19

Annotation: RpiB/LacA/LacB family sugar-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02502: LacAB_rpiB
  • amino acids 3 to 115 (113 residues), 77.6 bits, E=9.7e-26
• PF12408: DUF3666
  • amino acids 164 to 209 (46 residues), 78.1 bits, 2.2e-26

Best Hits

KEGG orthology group: None (inferred from 95% identity to dda:Dd703_1562)

MetaCyc: 64% identical to 5-dehydro-4-deoxy-D-glucuronate isomerase monomer (Streptococcus agalactiae NEM316)
4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase. [EC: 5.3.1.17]

Predicted SEED Role

"predicted 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase (EC 5.3.1.17)" (EC 5.3.1.17)

MetaCyc Pathways

• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (5/5 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (19/31 steps found)

KEGG Metabolic Maps

• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.17

Use Curated BLAST to search for 5.3.1.17

Sequence Analysis Tools

See A0A7L9RF43 at UniProt or InterPro

Protein Sequence (212 amino acids)

>HGI48_RS13325 RpiB/LacA/LacB family sugar-phosphate isomerase (Dickeya dianthicola 67-19)
MKIALINENSQAAKNAIIATALSKAVEPQGHTVYNYGQYAVEDAAQLTYIQNGILTAILL
NSGAADFVVTGCGTGQGAMLACNSFPGVICGLVVDPSDAYLFSQINNGNAVSLPYAKGFG
WGAELNLENLFTQLFKEEGGRGYPSDRVAPQQRNKKILDAVKAVTYNDLISILKGLDQDL
VKGAIAGPKFQEYFFANSTNAELTSYIKSRLN