Protein Info for HGI48_RS12945 in Dickeya dianthicola 67-19

Annotation: aliphatic sulfonate ABC transporter permease SsuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 signal peptide" amino acids 1 to 47 (47 residues), see Phobius details transmembrane" amino acids 70 to 90 (21 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 168 to 185 (18 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 80 to 247 (168 residues), 101.2 bits, see alignment E=3e-33

Best Hits

Swiss-Prot: 80% identical to SSUC_ECOLI: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Escherichia coli (strain K12)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 97% identity to ddd:Dda3937_03509)

MetaCyc: 80% identical to aliphatic sulfonate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9REX1 at UniProt or InterPro

Protein Sequence (263 amino acids)

>HGI48_RS12945 aliphatic sulfonate ABC transporter permease SsuC (Dickeya dianthicola 67-19)
MRKRLTPLGERLMPWLLPLLLVAVWQLASSVGWLSSRILPSPQAVAVTFWRLTRSGELWQ
HLSISTWRALTGFAIGGALGLAIGFITGLSRTGERLLDTSVQMLRNVPHLALIPLVILWF
GIEESAKIFLVALGTLFPVYLNTYHGIRNIDGGLLEMSRSYGLSGFRLFREVLLPGALPS
IMVGVRFSLGLMWLTLIVAETISASSGIGYLAMNAREFLQTDVVVVAIILYALLGKLADV
IALTLERIWLRWHPSWQLTEQHA