Protein Info for HGI48_RS12660 in Dickeya dianthicola 67-19

Annotation: lactoylglutathione lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 PF00903: Glyoxalase" amino acids 2 to 123 (122 residues), 103.8 bits, see alignment E=1.3e-33 TIGR00068: lactoylglutathione lyase" amino acids 2 to 133 (132 residues), 223.7 bits, see alignment E=3.3e-71 PF13669: Glyoxalase_4" amino acids 5 to 109 (105 residues), 37.9 bits, see alignment E=3.1e-13 PF18029: Glyoxalase_6" amino acids 7 to 123 (117 residues), 26.9 bits, see alignment E=9.8e-10

Best Hits

Swiss-Prot: 84% identical to LGUL_ECO57: Lactoylglutathione lyase (gloA) from Escherichia coli O157:H7

KEGG orthology group: K01759, lactoylglutathione lyase [EC: 4.4.1.5] (inferred from 96% identity to dze:Dd1591_1720)

MetaCyc: 84% identical to lactoylglutathione lyase (Escherichia coli K-12 substr. MG1655)
Lactoylglutathione lyase. [EC: 4.4.1.5]

Predicted SEED Role

"Lactoylglutathione lyase (EC 4.4.1.5)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 4.4.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CY41 at UniProt or InterPro

Protein Sequence (135 amino acids)

>HGI48_RS12660 lactoylglutathione lyase (Dickeya dianthicola 67-19)
MRLLHTMLRVGDLPRAIDFYTKVLGMRLLRTSDNPEYKYSLAFVGYTEESEGAVIELTYN
WGVDSYELGTAFGHIALGVDDVAGTCERIRQAGGKVTREAGPVKGGTTVIAFVEDPDGYK
IELIERSQAGQGLGG