Protein Info for HGI48_RS12410 in Dickeya dianthicola 67-19

Annotation: tRNA 2-thiocytidine(32) synthetase TtcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF01171: ATP_bind_3" amino acids 42 to 205 (164 residues), 51.5 bits, see alignment E=5.2e-18

Best Hits

Swiss-Prot: 90% identical to TTCA_PECAS: tRNA-cytidine(32) 2-sulfurtransferase (ttcA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K14058, tRNA 2-thiocytidine biosynthesis protein TtcA (inferred from 99% identity to ddd:Dda3937_03138)

MetaCyc: 88% identical to tRNA cytosine32 2-sulfurtransferase TtcA (Escherichia coli K-12 substr. MG1655)
2.8.1.M2 [EC: 2.8.1.M2]

Predicted SEED Role

"tRNA(Cytosine32)-2-thiocytidine synthetase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9REN2 at UniProt or InterPro

Protein Sequence (313 amino acids)

>HGI48_RS12410 tRNA 2-thiocytidine(32) synthetase TtcA (Dickeya dianthicola 67-19)
MSENQSVTPKEQYNLNKLQKRLRRNVGEAIVDFNMIEDGDRIMVCLSGGKDSYTMLEILR
NLQQSAPVNFSLVAVNLDQKQPGFPEHVLPQYLDSIGVEYKIVEENTYGIVKEKIPEGKT
TCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYGGKLKGMPPKLVSDDG
KHVVIRPLAYCREKDIERFADARQFPIIPCNLCGSQPNLQRQVIKDMLRDWDKRHPGRIE
TMFSAMQNAVPSHLCDTNLFDFKSIRQGSEVVDGGDLAFDREEMPLQPAGWQPDEDEEDN
ARPLERLNVLEIR