Protein Info for HGI48_RS12350 in Dickeya dianthicola 67-19

Annotation: iron-sulfur cluster-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00273: iron-sulfur cluster-binding protein
  • amino acids 18 to 453 (436 residues), 732.1 bits, E=1e-224
• PF02589: LUD_dom
  • amino acids 72 to 294 (223 residues), 175.9 bits, E=2.8e-55
• PF13183: Fer4_8
  • amino acids 310 to 376 (67 residues), 53.5 bits, E=1e-17
• PF13534: Fer4_17
  • amino acids 311 to 376 (66 residues), 32.6 bits, E=3.3e-11
• PF11870: LutB_C
  • amino acids 387 to 468 (82 residues), 45.2 bits, E=3.5e-15

Best Hits

Swiss-Prot: 85% identical to YKGF_ECOLI: Uncharacterized electron transport protein YkgF (ykgF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_04340)

MetaCyc: 60% identical to component of an iron-sulfur oxidase linked to L-lactate utilization (Bacillus subtilis subtilis 168)
L-lactate dehydrogenase. [EC: 1.1.1.27]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

MetaCyc Pathways

• hexitol fermentation to lactate, formate, ethanol and acetate (18/19 steps found)
• superpathway of glucose and xylose degradation (16/17 steps found)
• homolactic fermentation (12/12 steps found)
• superpathway of anaerobic sucrose degradation (17/19 steps found)
• Bifidobacterium shunt (13/15 steps found)
• heterolactic fermentation (15/18 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (8/13 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.27

Sequence Analysis Tools

See A0A7L9RE96 at UniProt or InterPro

Protein Sequence (473 amino acids)

>HGI48_RS12350 iron-sulfur cluster-binding protein (Dickeya dianthicola 67-19)
MFLKTSDVAFKTRIKQQIDDPIMRNAVANAQQRIGANRQKMVDELGHWEDWRERASQIRE
HVLANLDAYLYQLSERVSANGGQVFFAKTKEDATGYILQVARSKQAKKVVKAKSMVTEEI
GMNHVLQEAGIQVIETDLGEYILQLDGDPPSHIVVPAIHKDRHQIRRVLHEKLGYDGPET
PEAMTLFIRHKIRQDFLSAEVGVTGCNFAVAETGSVCLMTNEGNARMCTTLPKTHIAVMG
MERIAPTFEEVDVLITMLARSAVGARLTGYNTWLTGPREAGNVDGPEEFHLVIVDNGRST
ILGSQFQDILRCIRCGACMNTCPAYRHIGGHGYGSIYPGPIGAVISPLLGGYDDFKDLPY
ACSLCTACDSVCPVKIPLSKLILKHRQVMAEGGLTPKGEQSAIKLFAYANSHPRLWKVGM
IAGAHAARWFIKEGKMPLNIGAIGEWTQARDLPQADGESFRSWFKKHKAQGNQ