Protein Info for HGI48_RS12340 in Dickeya dianthicola 67-19

Annotation: L-lactate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 50 (20 residues), see Phobius details amino acids 57 to 81 (25 residues), see Phobius details amino acids 107 to 140 (34 residues), see Phobius details amino acids 157 to 164 (8 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details amino acids 335 to 355 (21 residues), see Phobius details amino acids 376 to 398 (23 residues), see Phobius details amino acids 407 to 426 (20 residues), see Phobius details amino acids 495 to 514 (20 residues), see Phobius details TIGR00795: transporter, lactate permease (LctP) family" amino acids 1 to 510 (510 residues), 399.7 bits, see alignment E=1.2e-123 PF02652: Lactate_perm" amino acids 9 to 508 (500 residues), 422 bits, see alignment E=2e-130

Best Hits

KEGG orthology group: K03303, lactate transporter, LctP family (inferred from 96% identity to ddd:Dda3937_00125)

Predicted SEED Role

"L-lactate permease" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9REQ3 at UniProt or InterPro

Protein Sequence (516 amino acids)

>HGI48_RS12340 L-lactate permease (Dickeya dianthicola 67-19)
MYEYLQFSLGVLPLLIMIILILKIKMPIHHSVLITLVITAILSVTVWHTPLQTLGSAIGY
GVIKGLWPIIIVILGAIYSYNLMQETRSMDVLRDVLASISDDRRIQVLLISWCFGGFLEA
AAGYGTAVAIPIGILIALGFNPLKAAIASLVANTVPTAFGAVGIPVSILAEQVHLPVTSL
GGTIILQLALFNILLPFVIIAIIGDGVKAIRGVVGITLVCGITTLIPQYFVAVHLGAELP
AFAGSLVSLIAVAAMGRARKGKTDPHYLIQNNKSSGALPSGRDLLKACSIYMLIFTFILL
CSPLFPGIKQIVAHVTSTLYFPLAEGKALSLKIDWIATPGVLIIIATLLGGFIQGASLGK
MLHVLVNTIKQLKNSIIAITTIVAMATIMDVSGLIATLAQTLVNMTGGAYVFIAPVIGAL
GTFVTGSDTNSNVLFGKLQTVAAEKLHIDPIWLAAANTSGATGGKMISPQSIAIAVSATR
MDGQGSAIMAGTLKYCTAYIFILGLKVGLVYYLFMS