Protein Info for HGI48_RS12205 in Dickeya dianthicola 67-19

Annotation: phage major tail tube protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 TIGR01611: phage major tail tube protein" amino acids 3 to 172 (170 residues), 169.1 bits, see alignment E=3.8e-54 PF04985: Phage_tube" amino acids 4 to 171 (168 residues), 208 bits, see alignment E=3.9e-66

Best Hits

Swiss-Prot: 70% identical to TUBE_BPP2: Tail tube protein (FII) from Escherichia phage P2

KEGG orthology group: K06908, (no description) (inferred from 99% identity to ddc:Dd586_1778)

Predicted SEED Role

"Phage major tail tube protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CE99 at UniProt or InterPro

Protein Sequence (172 amino acids)

>HGI48_RS12205 phage major tail tube protein (Dickeya dianthicola 67-19)
MALPRKLKYLNLFNDGMSYMGQVHSVTLPKLTRKLENYRGGGMQGSAPVDFGLDNDALVM
EWNMGGLPDSAFWSQYALPGADAVPLRFAGSYQRDDTGDITAVEIVLRGRHKSIDSGESK
QGEETDVRVSTQCTYYKLIIDGVDMIEIDTINMIEKVNGVDRLEQHRRNIGL