Protein Info for HGI48_RS12160 in Dickeya dianthicola 67-19

Annotation: phage tail protein I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF09684: Tail_P2_I" amino acids 7 to 143 (137 residues), 185.9 bits, see alignment E=1.7e-59 TIGR01634: phage tail protein I" amino acids 7 to 143 (137 residues), 202 bits, see alignment E=1.7e-64

Best Hits

Swiss-Prot: 63% identical to BPI_BPP2: Baseplate protein I (I) from Escherichia phage P2

KEGG orthology group: None (inferred from 95% identity to ddd:Dda3937_00031)

Predicted SEED Role

"Phage tail fibers"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9REC2 at UniProt or InterPro

Protein Sequence (203 amino acids)

>HGI48_RS12160 phage tail protein I (Dickeya dianthicola 67-19)
MNKSPLLPPGSSTLEHAVTVTGARLEAVPIPLRQLWNPDTCPVELLPYLAWTLSVDRWDE
SWSEAVKRKIIRDAFFIHRHKGTIGALRRVVEPLGYLIRIKEWWQTGDAPGTFRLDIGIQ
DSGITEESFQELERLIADAKPVSRQMLGLNINLDSSGTLLMGAGSYSGDELTIYPYFPET
ISVSGEEITGAAIHLIDDIYVGG