Protein Info for HGI48_RS12155 in Dickeya dianthicola 67-19

Annotation: baseplate assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF04865: Baseplate_J" amino acids 118 to 261 (144 residues), 87.9 bits, see alignment E=3.5e-29

Best Hits

Swiss-Prot: 74% identical to BPJ_BPP2: Baseplate protein J (J) from Escherichia phage P2

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_00030)

Predicted SEED Role

"Baseplate assembly protein J"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9REA6 at UniProt or InterPro

Protein Sequence (302 amino acids)

>HGI48_RS12155 baseplate assembly protein (Dickeya dianthicola 67-19)
MPLIDLSQLPAPSVVETLDYETLYATRKETLLSLYSAEERGAIARALTLESEPMVKLLQE
NAYRELLLRQRINEAAQAGMLAFAQGNDLDQLGANVNVSRLVITPADATTVPPTAAVMES
DTDFRLRIQQAYEGLSVAGSIGAYQFHGRSASGQVADISVISPGPAQVLVSVLSRENDGT
ASDALLATVNAALNAEDVRPVADRVTVKSAVIVPYDINATLYLYPGPEVEPIRAAAEKKL
QSYVSSQHRLGRDIRRSAIYAALHVEGVQRVELARPAADIVLDDTQASHCTGYTLTLGGT
DE