Protein Info for HGI48_RS12045 in Dickeya dianthicola 67-19

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 43 to 66 (24 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 231 to 248 (18 residues), see Phobius details amino acids 266 to 282 (17 residues), see Phobius details amino acids 288 to 311 (24 residues), see Phobius details amino acids 323 to 345 (23 residues), see Phobius details amino acids 378 to 395 (18 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 8 to 394 (387 residues), 118.6 bits, see alignment E=1.6e-38

Best Hits

KEGG orthology group: None (inferred from 95% identity to ddd:Dda3937_03785)

Predicted SEED Role

"Lysophospholipid acyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9REL0 at UniProt or InterPro

Protein Sequence (422 amino acids)

>HGI48_RS12045 acyltransferase (Dickeya dianthicola 67-19)
MKVRERFIGLEWLRFLLGCYVMIYHTVHIYPQREKIPFLSELTSMGFFATSTFFVLSGFL
LTHVYLRDGQLREPARHFLAKRLFNLYPIHIIGLVSSIVVVSLMHWLAIAPEGQVASARF
VIYDSNDPSVAPETLRHYMDNAQLAFNGLLQLLMLQAWNPYFLTFNAPLWSVSTLFFFYL
LFPLLAPRLLGSRYPRLWLMVMCVLYLLPPIWVIWHQLYGVPYTGLLQRSPLLRLPEFLA
GVLGYAIFRQYRDGTLPALTRMQRKALGAFISLSFIVATWLFTHGERYWYFLLHNGLLLP
AQVALVFLCAHVREPDSETLKTWATRLGAASLSIFALHVPLFNLFRTLEQLLRGDPLQCF
TDWTACIDAAGKVELSMTGYGVFLLTTVALCVVFQEQAVIRMKQALTERFLGRRFHPSRS
AA