Protein Info for HGI48_RS11810 in Dickeya dianthicola 67-19

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 PF00005: ABC_tran" amino acids 21 to 178 (158 residues), 112.5 bits, see alignment E=7.6e-36 amino acids 321 to 472 (152 residues), 122.6 bits, see alignment E=5.9e-39 PF08352: oligo_HPY" amino acids 229 to 272 (44 residues), 23.3 bits, see alignment 2e-08 amino acids 524 to 549 (26 residues), 26.7 bits, see alignment (E = 1.8e-09)

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 94% identity to ddc:Dd586_1860)

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9REG8 at UniProt or InterPro

Protein Sequence (559 amino acids)

>HGI48_RS11810 ABC transporter ATP-binding protein (Dickeya dianthicola 67-19)
MTPLLEIQDLRVTFPGHQAVRGLDLALNPGETLALVGESGCGKSATALSIMRLVSAPGQV
AGRILFDGQDLLALPDTAMRQLRGNAISMIFQEPMTSLNPVLTIGQQVVETLRTHQPLTP
AQARARAIELLDLVKIPEPARRIDDYPHQLSGGQRQRVMIAMAVACQPKLLIADEPTTAL
DVTIQAQILALLDQLRRELSMGLLLITHDLGVVEQWADRVAVMVGGRKVEEASTDVLFQQ
PQHPYTRGLLATSLHLADDLHYRRQRLPEIRHPDNGDAGQVTVVTPPLRRVPAPDTTRAP
LLSLHQVHTRYTTPQGVVNAVKDMSLDIYPGETLGLVGESGCGKSTLSKTILRLLPVAAG
RILFDGQDITPLNERQLQPLRRRVQMIFQDPYASLNPRHDVQRILERPLIVHGVTRRAQR
QRLIDQVLARVGLPQSSLQRYPHEFSGGQRQRIGIARALVVNPSLVICDEPVSALDVSIR
AQILNLLVELKSEMGLSLLFISHDLSVVRYIADRVMVMQHGECVESGDYQQIWRQPQHPY
TRLLLDSVPGRRQAPAVFP