Protein Info for HGI48_RS11700 in Dickeya dianthicola 67-19

Annotation: sigma-54-dependent Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF00158: Sigma54_activat" amino acids 33 to 189 (157 residues), 196.6 bits, see alignment E=7.7e-62 PF14532: Sigma54_activ_2" amino acids 35 to 193 (159 residues), 56 bits, see alignment E=1.6e-18 PF07728: AAA_5" amino acids 46 to 164 (119 residues), 31.6 bits, see alignment E=4.7e-11 PF00004: AAA" amino acids 48 to 182 (135 residues), 26.7 bits, see alignment E=2.1e-09 PF02954: HTH_8" amino acids 280 to 318 (39 residues), 22.2 bits, see alignment 2.9e-08

Best Hits

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_03345)

Predicted SEED Role

"Formate hydrogenlyase transcriptional activator" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RDZ6 at UniProt or InterPro

Protein Sequence (327 amino acids)

>HGI48_RS11700 sigma-54-dependent Fis family transcriptional regulator (Dickeya dianthicola 67-19)
MTIRNSNEPVQSLHCASHHSLLTHPSEDIHGSLSSLIHTIAPLNVDIVLEGETGTGKDTL
ARRIHQLSGCVGPLVAVNCAAVPETLAESELFGVVSGAYTGASRSRAGYLETADKGILFL
DEIDSMPLTLQAKMLRVLESRGIERLGSTQFKPVDMRVIVATQTPLQKLVDEGRFRRDLY
FRLDTVKIQLPTLRSRTEVILPLFQRFLREASVRLKRPAPGLSAIMQEQLLMHGWPGNIR
ELKAAAERWVLGLSPMPIASDGDGQDAGENTPLTSLKVRLRRIERFLIQEALQRNDHCID
TVVNELGIPKRTLYHRIKLLNVAARGL