Protein Info for HGI48_RS11575 in Dickeya dianthicola 67-19

Annotation: ferrous iron transport protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 PF04023: FeoA" amino acids 1 to 72 (72 residues), 62.5 bits, see alignment E=1.6e-21

Best Hits

Swiss-Prot: 45% identical to FEOA_ECOLI: Fe(2+) transport protein A (feoA) from Escherichia coli (strain K12)

KEGG orthology group: K04758, ferrous iron transport protein A (inferred from 97% identity to ddc:Dd586_1922)

Predicted SEED Role

"Ferrous iron transport protein A" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RDX7 at UniProt or InterPro

Protein Sequence (75 amino acids)

>HGI48_RS11575 ferrous iron transport protein A (Dickeya dianthicola 67-19)
MTLEALAVGTQWRVLGFQKGSSDYRKRLLALGVTPGVEFSVSRVAPLGDPIELRLRGAAI
SVRKGEAQILILEKC