Protein Info for HGI48_RS11465 in Dickeya dianthicola 67-19

Annotation: 50S ribosomal protein L20

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 TIGR01032: ribosomal protein bL20" amino acids 1 to 114 (114 residues), 176.8 bits, see alignment E=7.3e-57 PF00453: Ribosomal_L20" amino acids 3 to 109 (107 residues), 164 bits, see alignment E=5e-53

Best Hits

Swiss-Prot: 98% identical to RL20_SALAR: 50S ribosomal protein L20 (rplT) from Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

KEGG orthology group: K02887, large subunit ribosomal protein L20 (inferred from 97% identity to ecc:c2113)

MetaCyc: 97% identical to 50S ribosomal subunit protein L20 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L20p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CQV0 at UniProt or InterPro

Protein Sequence (118 amino acids)

>HGI48_RS11465 50S ribosomal protein L20 (Dickeya dianthicola 67-19)
MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL
WIARINAAARQNGLSYSKFINGLKKASVEIDRKILADIAVFDKVAFSALVEKAKSALA