Protein Info for HGI48_RS11245 in Dickeya dianthicola 67-19

Annotation: septum site-determining protein MinD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 TIGR01968: septum site-determining protein MinD" amino acids 2 to 267 (266 residues), 366.2 bits, see alignment E=4.4e-114 PF10609: ParA" amino acids 3 to 159 (157 residues), 54.8 bits, see alignment E=3.3e-18 PF13614: AAA_31" amino acids 3 to 157 (155 residues), 75 bits, see alignment E=2.7e-24 PF09140: MipZ" amino acids 3 to 144 (142 residues), 37.4 bits, see alignment E=6.3e-13 PF02374: ArsA_ATPase" amino acids 5 to 40 (36 residues), 37.9 bits, see alignment 4.4e-13 PF01656: CbiA" amino acids 5 to 227 (223 residues), 71.8 bits, see alignment E=1.9e-23

Best Hits

Swiss-Prot: 93% identical to MIND_ECO57: Septum site-determining protein MinD (minD) from Escherichia coli O157:H7

KEGG orthology group: K03609, septum site-determining protein MinD (inferred from 98% identity to ddd:Dda3937_04710)

Predicted SEED Role

"Septum site-determining protein MinD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CYU5 at UniProt or InterPro

Protein Sequence (270 amino acids)

>HGI48_RS11245 septum site-determining protein MinD (Dickeya dianthicola 67-19)
MARIIVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVIDFDIGLRNLDLIMGCERRVVYDF
VNVIQNDATLNQALIKDKRTENLYILPASQTRDKEALTREGVDKVLKDLANMEFDFIVCD
SPAGIETGALMALYFADEAIITTNPEVSSVRDSDRILGILSSKSRRAEQGQEPIKEHLLL
TRYNPGRVSRGDMLSMEDVLEILRIPLVGVIPEDQSVLRASNQGEPVILDKDADAGKAYE
DTVDRLLGEERPYRFIEEEKKSFLKRLFGG