Protein Info for HGI48_RS11075 in Dickeya dianthicola 67-19

Annotation: sigma-70 family RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 18 to 170 (153 residues), 61.5 bits, see alignment E=3.7e-21 PF04542: Sigma70_r2" amino acids 24 to 87 (64 residues), 33.2 bits, see alignment E=7.3e-12 PF07638: Sigma70_ECF" amino acids 45 to 172 (128 residues), 23.4 bits, see alignment E=9.8e-09 PF08281: Sigma70_r4_2" amino acids 116 to 166 (51 residues), 48.7 bits, see alignment E=9.4e-17 PF04545: Sigma70_r4" amino acids 124 to 165 (42 residues), 30.8 bits, see alignment 3.4e-11

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 83% identity to pam:PANA_1604)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RJG3 at UniProt or InterPro

Protein Sequence (183 amino acids)

>HGI48_RS11075 sigma-70 family RNA polymerase sigma factor (Dickeya dianthicola 67-19)
MLNPEYQHEDKKITTSEVRQQLAAHLTRLWRYGLVLSRSHDAAEELVQSTCVRALEKSAQ
FTPGTRIDRWLFSILHSIWISDLRARRVRMGQGFVESDELLAPDTHALNDDRRHYQKIMQ
RVNALPEAQRNAIFLVYVEGFTYQEAADTLSVPIGTIMSRLAAARTILAQSVDAPVSEKE
KRS