Protein Info for HGI48_RS10770 in Dickeya dianthicola 67-19

Annotation: HlyD family type I secretion periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 24 to 445 (422 residues), 396.4 bits, see alignment E=8.2e-123 PF00529: CusB_dom_1" amino acids 36 to 401 (366 residues), 57.6 bits, see alignment E=1.9e-19 PF13437: HlyD_3" amino acids 297 to 398 (102 residues), 56.5 bits, see alignment E=8e-19

Best Hits

Swiss-Prot: 97% identical to PRTE_DICCH: Proteases secretion protein PrtE (prtE) from Dickeya chrysanthemi

KEGG orthology group: K12537, protease secretion protein HasE (inferred from 97% identity to ddd:Dda3937_01652)

Predicted SEED Role

"ABC-type protease exporter, membrane fusion protein (MFP) family component PrtE/AprE" in subsystem Protein secretion by ABC-type exporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RDM0 at UniProt or InterPro

Protein Sequence (445 amino acids)

>HGI48_RS10770 HlyD family type I secretion periplasmic adaptor subunit (Dickeya dianthicola 67-19)
MDITTQDELNEAAMRDRAGRDEERALRLGWWLVLAGFGGFLLWALLAPLDKGVAVQGNVV
VSGNRKVIQHMQGGIVDRIQAKEGDRVAAGQVLLTLNAVDARTTSEGLGSQYDQLIAREA
RLLAEQRNQSSLAATPRLTQARQRPEMAAIIALQEDLLHSRQQALKLETDGMRASIDGME
TSLGALQKVMTSKQSEQSTLSQQLQGLRPLAADNYVPRNKMLETERLFAQVSGELAQTSG
EVGRTRRDIQQQKLRIAQRQQEYDKEVNSELSDVQAKLNEVISQREKADFNLANVQVRAP
VAGTVVDMKIFTEGGVIAPGQVMMEIVPEDQPLLVDGRIPVEMVNKVWSGLPVELQFTAF
SQSTTPRVPGTVTLLSADRLVDEKDGTPYYSLRIQVSEEGKRSLHGLEIKPGMPVQGFVR
TGERSFINYLFKPLMDRMHLALTEE