Protein Info for HGI48_RS10765 in Dickeya dianthicola 67-19

Annotation: TolC family outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 26 to 448 (423 residues), 469.2 bits, see alignment E=6.3e-145 PF02321: OEP" amino acids 29 to 221 (193 residues), 78.1 bits, see alignment E=3.9e-26 amino acids 247 to 431 (185 residues), 94 bits, see alignment E=5e-31

Best Hits

Swiss-Prot: 93% identical to PRTF_DICCH: Proteases secretion protein PrtF (prtF) from Dickeya chrysanthemi

KEGG orthology group: None (inferred from 92% identity to ddd:Dda3937_01653)

Predicted SEED Role

"ABC-type protease exporter, outer membrane component PrtF/AprF" in subsystem Protein secretion by ABC-type exporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RDG6 at UniProt or InterPro

Protein Sequence (467 amino acids)

>HGI48_RS10765 TolC family outer membrane protein (Dickeya dianthicola 67-19)
MRRKAVLLMVVGLLEVLSLSGGSAQAVGLLDAWELALRNDAQLQAAGFERDAGQEEVAIG
RAGLLPSLQYNYGANYSHSKVTQRDRTVDNTTQRDYNNYVSTLTLRQPLLDYAAWARYQQ
GITRKLMADQRFRDRSQDLMVRLYQAWSEALLAQEKLLLLDAQRRAYQEQLALNRRLLAA
GEGTQTDLRETEARYTVTEAQRIEQEDTLDAAMTDLENMMGAPLQIQDLSPLALDTLPDN
VTENRSLSQWRELAVRHNAKLAVQRENVDYSRYEIERNRAGHLPTLDLVASTRNSLSESE
YNYNQKYDTQTVGLQVRVPLYSGGAVSASMRQASAEYQQSQAELDNQTRQTFAELRRQFN
LCANGAAKIRAWQMSVTAAEEAIRATRQSVAGGERINLDVLMAEQEWYNARRELTEVKYR
WLQAWLNLRYTGGTLNEQDMMQLAAWFQSADGTNKNRGKTASGNKVN