Protein Info for HGI48_RS10680 in Dickeya dianthicola 67-19

Annotation: ATP-dependent dethiobiotin synthetase BioD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF13500: AAA_26" amino acids 3 to 205 (203 residues), 110.8 bits, see alignment E=7.7e-36 TIGR00347: dethiobiotin synthase" amino acids 6 to 171 (166 residues), 135.4 bits, see alignment E=1.1e-43 PF01656: CbiA" amino acids 6 to 204 (199 residues), 50.3 bits, see alignment E=2.3e-17

Best Hits

Swiss-Prot: 70% identical to BIOD_YERPS: ATP-dependent dethiobiotin synthetase BioD (bioD) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K01935, dethiobiotin synthetase [EC: 6.3.3.3] (inferred from 99% identity to ddd:Dda3937_04131)

MetaCyc: 68% identical to dethiobiotin synthetase BidA (Escherichia coli K-12 substr. MG1655)
Dethiobiotin synthase. [EC: 6.3.3.3]

Predicted SEED Role

"Dethiobiotin synthetase (EC 6.3.3.3)" in subsystem Biotin biosynthesis (EC 6.3.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.3.3

Use Curated BLAST to search for 6.3.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RDJ3 at UniProt or InterPro

Protein Sequence (223 amino acids)

>HGI48_RS10680 ATP-dependent dethiobiotin synthetase BioD (Dickeya dianthicola 67-19)
MLKRMFVTGTDTAVGKTVVSKALLQALTKTGKTVVGYKPVAKSCTETEEGLRNKDALVLQ
EASSIPLSYQQVNPVSLQEDEISASELEINYCAMTEGLNQLSGLSDMVVVEGSGGWRTLM
NDMRTYSEWVVQEQLPVVLVVGIKLGCINHALLTAQAVINDGLPLVGWVANRINPGLANY
AEIIHALREKIPAPQLGELPYLPRAEQRDLSAYIDLSAIKQSF