Protein Info for HGI48_RS10665 in Dickeya dianthicola 67-19

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 32 to 57 (26 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 302 to 321 (20 residues), see Phobius details amino acids 327 to 351 (25 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details amino acids 390 to 408 (19 residues), see Phobius details PF07690: MFS_1" amino acids 39 to 258 (220 residues), 105.5 bits, see alignment E=3e-34 PF00083: Sugar_tr" amino acids 69 to 215 (147 residues), 41.4 bits, see alignment E=9e-15

Best Hits

Swiss-Prot: 72% identical to YNFM_ECOLI: Inner membrane transport protein YnfM (ynfM) from Escherichia coli (strain K12)

KEGG orthology group: K08224, MFS transporter, YNFM family, putative membrane transport protein (inferred from 96% identity to ddd:Dda3937_04128)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RJF3 at UniProt or InterPro

Protein Sequence (416 amino acids)

>HGI48_RS10665 MFS transporter (Dickeya dianthicola 67-19)
MSVSVTDDIQPQHTTHAPAYRSPFITRGTPTFIRVTLALFSAGLATFALLYCVQPILPVL
SQAFGVSPATSSLSLSVSTITMAVGLLFTGPLSDTIGRKNVMVVSLLLASVFTLMGSMMT
NWAGLLTMRALVGLSLSGVAAVAMTYLSEEIHPSVVAFSMGLYISGNSIGGMSGRLLTGV
ITDFFDWRASIASIGVVALLASVTFWRILPDSRHFRAGSLRPKTLWINARLHWRDAGLPL
LFAEGFLLMGTFVTLFNYIGYRLLGAPYNLSQTVVGLLSVVYLTGSYASPRAGAMIARFG
RGAVLVGSIALMLSGLLLTLFSSLPVMFVGMMLFAAGFFAAHSVASSWIGVRALRARGQA
SSQYLFCYYLGSSLAGTSGGFFWYHYGWTGLVLFLSCLLMLALLLGFKLKSLKTRV