Protein Info for HGI48_RS10650 in Dickeya dianthicola 67-19

Annotation: mannose-6-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20511: PMI_typeI_cat
  • amino acids 1 to 150 (150 residues), 136 bits, E=2.1e-43
• TIGR00218: mannose-6-phosphate isomerase, class I
  • amino acids 2 to 384 (383 residues), 383.2 bits, E=6.6e-119
• PF20512: PMI_typeI_hel
  • amino acids 157 to 236 (80 residues), 51.9 bits, E=1.8e-17
• PF21621: MPI_cupin_dom
  • amino acids 311 to 389 (79 residues), 92.3 bits, E=3e-30
• PF01238: PMI_typeI_C
  • amino acids 311 to 355 (45 residues), 30.7 bits, 5.7e-11

Best Hits

Swiss-Prot: 72% identical to MANA_ECOLI: Mannose-6-phosphate isomerase (manA) from Escherichia coli (strain K12)

KEGG orthology group: K01809, mannose-6-phosphate isomerase [EC: 5.3.1.8] (inferred from 96% identity to ddd:Dda3937_04125)

MetaCyc: 72% identical to mannose-6-phosphate isomerase (Escherichia coli K-12 substr. MG1655)
Mannose-6-phosphate isomerase. [EC: 5.3.1.8]

Predicted SEED Role

"Mannose-6-phosphate isomerase (EC 5.3.1.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.3.1.8)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• GDP-mannose biosynthesis (4/4 steps found)
• mannitol degradation II (4/4 steps found)
• D-mannose degradation I (2/2 steps found)
• D-mannose degradation II (2/2 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
• mannitol biosynthesis (2/3 steps found)
• 1,5-anhydrofructose degradation (3/5 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (9/14 steps found)
• β-(1,4)-mannan degradation (2/7 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.8

Sequence Analysis Tools

See A0A7L9RDT5 at UniProt or InterPro

Protein Sequence (394 amino acids)

>HGI48_RS10650 mannose-6-phosphate isomerase (Dickeya dianthicola 67-19)
MQKMRNSVQNYAWGSKHALTELYGIENPGNLPMAELWMGAHPKSSSLLLDEQGQAHNLRE
LINSDRPGFLGNAVAQRFGELPFLFKVLCAEQPLSIQVHPNKSAAEAGFDRENAAGIALD
SPQRNYKDANHKPELVFALTAYLAMNGFRELAEIARLLQPLADAHPAIAAFLQHPNSQTL
TTLFSSLLSMNGEQKAQAIAELNRVLDSQHGEPWDTIRFIAQFYPDDGGLFSPLLLNVVT
LKPGEAMFLYAETPHAYLQGVALEVMANSDNVLRAGLTPKYIDIPELLANVRFESKPAAS
LLTSPIKTANELRFPIPVDDFAFSLHYLTDAPQTLSQQSAAIVFCVEGQAVLEKGAQQVT
LLPGESCFIPAGESPVQVQGQGQIARVYNRPLMV