Protein Info for HGI48_RS10300 in Dickeya dianthicola 67-19

Annotation: signal peptide peptidase SppA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 614 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details TIGR00705: signal peptide peptidase SppA, 67K type" amino acids 16 to 605 (590 residues), 753.2 bits, see alignment E=1.8e-230 PF01343: Peptidase_S49" amino acids 139 to 288 (150 residues), 132.2 bits, see alignment E=1.6e-42 amino acids 390 to 540 (151 residues), 164.8 bits, see alignment E=1.5e-52 TIGR00706: signal peptide peptidase SppA, 36K type" amino acids 326 to 539 (214 residues), 171.4 bits, see alignment E=2e-54

Best Hits

Swiss-Prot: 67% identical to SPPA_SALTI: Protease 4 (sppA) from Salmonella typhi

KEGG orthology group: K04773, protease IV [EC: 3.4.21.-] (inferred from 97% identity to ddd:Dda3937_04043)

MetaCyc: 67% identical to protease IV, a signal peptide peptidase (Escherichia coli K-12 substr. MG1655)
3.4.21.-

Predicted SEED Role

"Signal peptide peptidase SppA (EC 3.4.21.-)" (EC 3.4.21.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RDC0 at UniProt or InterPro

Protein Sequence (614 amino acids)

>HGI48_RS10300 signal peptide peptidase SppA (Dickeya dianthicola 67-19)
MRTMWRIFSGIFRWGWRLLNFIREFILNLFLVFLILVGIGVYSQLKTPQAEPPRGALLLD
LTGVVVDKPSVNNKLRQFGREFFGVSASRHQENALFDIVDGIRQAKDDSNITGMVMDLSD
FVSADQPSLQYIGKALREFRDAGKPIFAVGDNFNQTQYYLASFANKIYLTPQGNIDLHGF
ATNNLYYKTLLDKLKVTTHIFRVGTYKSAVEPFIRDDMSPDAREADSRWISTLWQHYLDT
VAANRQITPQQLFPGAENLLAGLQALNGDTARYALENKLVDEVASRSAIEQSFIKAFGWD
AKSKNVNFTSIYDYAPTPPATSANEIAVVFANGTIVDGKETPGYVGGDTTAAQIRDARLD
PKVKAIVLRVNSPGGSVTASELIRSELAAARQAGKPVVVSMGGMAASGGYWISTPANAII
ASPSTLTGSIGIFGVVTTFENSLDSIGVHTDGVATSPLAALSQTRALPTEASQLMQLNIE
RGYQNFISLVAESRKKTPQEVDAIAQGHVWVGSDAKTNGLVDQLGDFDDAVKKAAELAKL
EHYQLSWYSGEPAFLDTMFSQVRSSVYAMLPSALQAIVPVAQLAQTVRAQTSVLDALNDP
QNRYALCLNCGDVR